SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B0DDC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B0DDC0
Domain Number 1 Region: 31-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000851
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 103-150
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000131
Family Hairy Orange domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B0DDC0
Sequence length 159
Comment (tr|A0A1B0DDC0|A0A1B0DDC0_PHLPP) Uncharacterized protein {ECO:0000313|VectorBase:PPAI005891-PA} KW=Complete proteome; Reference proteome OX=29031 OS=Phlebotomus papatasi (Sandfly). GN= OC=Psychodidae; Phlebotomus; Phlebotomus.
Sequence
EINGGPYPYCETGLNFSTNATFSEDDAEYHGRRGKTSRQDPLSHRIIEKRRRDRMNSCLA
DLSRLIPPQYQRKGRGRIEKTEIIEMAIRHIKSFQKQENVCRDRDTILADRYRRGYNDCL
TEAAKFLVAINDDDTICYKMIEHLKEHCGEIMKKDLTNF
Download sequence
Identical sequences A0A1B0DDC0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]