SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1A0E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1A0E5
Domain Number 1 Region: 10-131
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 8.89e-27
Family Thiamin pyrophosphokinase, catalytic domain 0.0023
Further Details:      
 
Domain Number 2 Region: 135-205
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000000000157
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B1A0E5
Sequence length 223
Comment (tr|A0A1B1A0E5|A0A1B1A0E5_9RHOB) Thiamine pyrophosphokinase {ECO:0000313|EMBL:ANP39968.1} KW=Complete proteome OX=1265309 OS=Ruegeria mobilis F1926. GN=K529_004240 OC=Rhodobacteraceae; Ruegeria.
Sequence
MTEVIVQETAPVTLIGGGDVTRSDLAEALAHAPGLVAIDSGADQALALGHRPRAVIGDFD
SVSDATRAALSDSILHLVEEQETTDFDKALRSVNAPLVLAVGVLGARLDHQLAALNVLVQ
PHAASCILIGAHELVVHLTTPLEVELNAGDVVSLFPLGPVTGRSEGLEWPIEGLNLSPMS
RIGTSNRATGPIRIEVDGPGLLAMLPRHCLSGLIQAMRAGRSC
Download sequence
Identical sequences A0A1B1A0E5
WP_005659528.1.13858 WP_005659528.1.14134 WP_005659528.1.14173 WP_005659528.1.16839 WP_005659528.1.17490 WP_005659528.1.22935 WP_005659528.1.30750 WP_005659528.1.31229 WP_005659528.1.37735 WP_005659528.1.4024 WP_005659528.1.47879 WP_005659528.1.50919 WP_005659528.1.54057 WP_005659528.1.54965 WP_005659528.1.57400 WP_005659528.1.58147 WP_005659528.1.5952 WP_005659528.1.61162 WP_005659528.1.66522 WP_005659528.1.73477 WP_005659528.1.75850 WP_005659528.1.82237 WP_005659528.1.9342 WP_005659528.1.9865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]