SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1C579 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1C579
Domain Number 1 Region: 3-128
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 8.76e-25
Family MOSC N-terminal domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 3-49,148-270
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.00000000000022
Family MOSC (MOCO sulphurase C-terminal) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B1C579
Sequence length 285
Comment (tr|A0A1B1C579|A0A1B1C579_RHILE) Molybdenum cofactor sulfurase {ECO:0000313|EMBL:ANP84880.1} KW=Complete proteome OX=384 OS=Rhizobium leguminosarum. GN=BA011_03410 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MLVSDLFIYPLKSARGIALPAADIDANGLPGDRRAMITDAQGHFITQRELPDLAGIEVRP
EASAFRLLMQGKTDISVPPPQPEARMDVIVWKSAVNAAVADPESNRQLSEWLGREVRLVF
FDGQARRTANAEWAGEATPVTFTDGYQILVTTTGSLKALNADLAAHGEGSVGMERFRPNI
VIDTDEAWAEDRWAAIEIAGIRFDLVKPCSRCIMTTQDQLTGSREGPNPMPAMGRIRMSA
DRRVPGPLFGWNVTPRGSGRITIGDTARIVEERPEGWALKRRAAA
Download sequence
Identical sequences A0A1B1C579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]