SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1DTU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1DTU2
Domain Number 1 Region: 10-87
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 3.53e-17
Family Tubulin chaperone cofactor A 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B1DTU2
Sequence length 162
Comment (tr|A0A1B1DTU2|A0A1B1DTU2_9APIC) Tubulin-specific chaperone A {ECO:0000256|RuleBase:RU364030} KW=Complete proteome; Reference proteome OX=208452 OS=Plasmodium coatneyi. GN=PCOAH_00003610 OC=Plasmodiidae; Plasmodium.
Sequence
MENTAAHFRLLKINHGAVRRLFKELTYYEKEEGELRTKVNSLQEQNKSAAEVTRAQEMLK
ETERVVPHIRSSLQSSLKKVCDIIYEHFSNVLQINDKTIQFSATHSEDTLKEVLSTHYEE
ICKEVDGLNETLAKVLLHMKQDALPIYTPAPTVAVPLTCVDI
Download sequence
Identical sequences A0A1B1DTU2
XP_019912700.1.73221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]