SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1KSU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1B1KSU7
Domain Number - Region: 9-127
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.00222
Family Chemotaxis phosphatase CheZ 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B1KSU7
Sequence length 148
Comment (tr|A0A1B1KSU7|A0A1B1KSU7_SERPL) Flagellar FliJ protein {ECO:0000256|PIRNR:PIRNR019404} KW=Complete proteome; Reference proteome OX=1154756 OS=Serratia plymuthica PRI-2C. GN=Q5A_015330 OC=Yersiniaceae; Serratia.
Sequence
MKPQSPLITLRDLAQDAVEQATQQLGQVRKAQQAAEQQLSMLLNYQDEYRQKLNHQLSDG
MDSSHWQNYQQFIGTLEQAIEQHRNQLMQWGQKVDHAMKHWQDKQQRLNAFDTLHTRAQS
AERQRENKRDQKLMDEFAQRSSQRNLHP
Download sequence
Identical sequences A0A1B1KSU7
WP_006321412.1.91790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]