SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1KU37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1KU37
Domain Number 1 Region: 2-165
Classification Level Classification E-value
Superfamily YfbU-like 2.09e-65
Family YfbU-like 0.000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B1KU37
Sequence length 165
Comment (tr|A0A1B1KU37|A0A1B1KU37_SERPL) UPF0304 protein Q5A_017535 {ECO:0000256|HAMAP-Rule:MF_00762} KW=Complete proteome; Reference proteome OX=1154756 OS=Serratia plymuthica PRI-2C. GN=Q5A_017535 OC=Yersiniaceae; Serratia.
Sequence
MMEMTHAQRLILSNQYKMMTLLDPDNTDRYRRLQTIIERGFGLQMRELDRDFGEMSEEVC
RTIINVMEMHHALQVSWDNLKEKQGIEARRLAFLGFDAATEARYLSYVRFLVTTEGRYTH
FDSGSHGFNAQTKMWEKYQRMLAIWLSCPRQYHLSAVEIAQIINA
Download sequence
Identical sequences A0A1B1KU37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]