SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1QKT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1QKT7
Domain Number 1 Region: 36-245
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.17e-111
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000023
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.00000000000184
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B1QKT7
Sequence length 245
Comment (tr|A0A1B1QKT7|A0A1B1QKT7_9EURY) Methyl-coenzyme-M reductase alpha-subunit {ECO:0000313|EMBL:ANT82161.1} OX=176307 OS=uncultured Methanosarcina sp. GN=mcrA OC=Methanosarcinaceae; Methanosarcina; environmental samples.
Sequence
FISAYAMCAGEAAVADLSFAAKHAALVSMGEMLPARRARGPNEPGGLSFGHLSDIIQTSR
TSQDPAKIALEVVGAGCMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDNNVYYDVDYIN
DKYNGAANLGTDNKVKATLDVVKDIATESTLYGIETYEKFPTALEDHFGGSQRATVLAAA
AGVATSLATANANAGLSGWYLSMYLHKEAWGRLGFFGFDLQDQCGATNVLSYQGDEGLPD
ELRGP
Download sequence
Identical sequences A0A1B1QKT7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]