SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1TBL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1TBL8
Domain Number 1 Region: 85-173
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.57e-16
Family eIF2alpha middle domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 8-86
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000593
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 175-258
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 0.0000000000000837
Family eIF-2-alpha, C-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B1TBL8
Sequence length 262
Comment (tr|A0A1B1TBL8|A0A1B1TBL8_9EURY) Eukaryotic translation initiation factor 2 alpha subunit family protein {ECO:0000313|EMBL:ANV79660.1} OX=1697135 OS=uncultured Candidatus Thalassoarchaea euryarchaeote. GN= OC=environmental samples.
Sequence
MSEAEEIWPDEGELLVCTVKGVKENGAYLNLGGYGDKEGFVFIGEVASGWVKNIRAHLRE
GQRVVAKVVTIKKDRERVDLSIKAVSAERRKDTLQKWKNQQRASQIMRVAAQRVDWDEEK
TEAISEEMIEKFGSLYGALEECAISETALSDSGFTGKWMKVVTELAVENIVPPFVEIRGI
FDIEVWGSEGVGAIRDALSAAELVVGDEEEVTLTCHYDGAPHYRVDIRAPDYSLAESSWE
AAKKAATEKINSVEGSISIERL
Download sequence
Identical sequences A0A1B1TBL8 A0A1Z9U0E2 A0A2E1J8N2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]