SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1ZMW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1ZMW2
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 5.36e-30
Family MOSC N-terminal domain-like 0.0094
Further Details:      
 
Domain Number 2 Region: 2-59,151-272
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 4.18e-18
Family MOSC (MOCO sulphurase C-terminal) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B1ZMW2
Sequence length 283
Comment (tr|A0A1B1ZMW2|A0A1B1ZMW2_9PSEU) Molybdenum cofactor biosysynthesis protein {ECO:0000313|EMBL:ANY07088.1} KW=Complete proteome; Reference proteome OX=1690815 OS=Pseudonocardia sp. HH130630-07. GN=AFB00_13210 OC=Pseudonocardia.
Sequence
MELTGLHRYPVKSCRGDDLQHAVVERAGLAGDRRWMVVSAGDGRMLTGRTHPRLVLAVPR
PVDGGLEIDGPGLPTLRVAEPDPAVVGPVPVRVHRWDTAGVPAGAGADAWFGELLGAPAR
LVHLDDPDRRPSDPEFSRPGDRVSFADGYPLLLTATDSLEALDALVATGPNAGEGPLSMS
RFRPNVVVSGAPAWAEDGWRRIRIGDAEFRAVKGCARCVFTTVDPVSAVKGREPMVTLAR
HRRFDKGVWFGMNLIPDNPGAEIRTGDPVEVLEAADPAPGPPR
Download sequence
Identical sequences A0A1B1ZMW2
WP_068797476.1.52357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]