SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B2E0Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B2E0Y9
Domain Number 1 Region: 28-146
Classification Level Classification E-value
Superfamily TM1646-like 3.01e-33
Family TM1646-like 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B2E0Y9
Sequence length 147
Comment (tr|A0A1B2E0Y9|A0A1B2E0Y9_9BACL) Uncharacterized protein {ECO:0000313|EMBL:ANY73625.1} KW=Complete proteome OX=1870820 OS=Paenibacillus ihbetae. GN=BBD41_14150 OC=Paenibacillus.
Sequence
MKINPGFRPLNSGIPAPDNSSRPVQQRSFSDMMQQQGERATHEELSRQMREIALQGDRLA
KSMTVRELKAYKLMVRRFLEETVRRGVKMKETRGWDRRGRGKRYNVIDEIDSVLLAMADE
LLYTEQGRIDLLNKVGEIRGMLINLVF
Download sequence
Identical sequences A0A1B2E0Y9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]