SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B2I715 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B2I715
Domain Number 1 Region: 5-140
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 9.94e-43
Family Peptidyl-tRNA hydrolase II 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B2I715
Sequence length 140
Comment (tr|A0A1B2I715|A0A1B2I715_9BACT) Uncharacterized protein {ECO:0000313|EMBL:ANZ45760.1} KW=Complete proteome OX=1197717 OS=Cloacibacillus porcorum. GN=BED41_12115 OC=Cloacibacillus.
Sequence
MEVQNEKCVMVIDEELPLGLIANTAGIIGITLGRHRPETVGPDVLDKSGRAHLGVIEFPV
PILRAGKEKLRAIRARLYEPEFSALLTVDFSDVAQSCKNYEEYIEKSAAVEEDELHYFGI
GICGAKKLVNRLTGDLPLLR
Download sequence
Identical sequences A0A1B2I715
WP_066746662.1.19415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]