SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B2J7M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B2J7M1
Domain Number 1 Region: 25-131
Classification Level Classification E-value
Superfamily GINS helical bundle-like 1.78e-32
Family PSF2 C-terminal domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 3-23
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.0000379
Family PSF2 N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B2J7M1
Sequence length 151
Comment (tr|A0A1B2J7M1|A0A1B2J7M1_PICPA) BA75_00849T0 {ECO:0000313|EMBL:ANZ73965.1} KW=Complete proteome OX=4922 OS=Komagataella pastoris (Yeast) (Pichia pastoris). GN=ATY40_BA7500849 OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Komagataella.
Sequence
MKRAEVPLWLGLILKQQDRCNIVTPSWLSINFLKKAYQEEVTYTTRFFRMPWNWLEISKM
ILDKAPDDMTEPPHQIRALIQDLREVRLIKARRGLKELNESYMQLDNLSLMEINELRPMV
VGVMDQLRKLQVGTNEDEEVSDEEAPLSYDI
Download sequence
Identical sequences A0A1B2J7M1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]