SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B2ZDH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1B2ZDH6
Domain Number - Region: 40-72
Classification Level Classification E-value
Superfamily SOCS box-like 0.0262
Family SOCS box-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B2ZDH6
Sequence length 74
Comment (tr|A0A1B2ZDH6|A0A1B2ZDH6_9VIRU) Capsid protein {ECO:0000256|RuleBase:RU361230} OX=687341 OS=Torque teno virus 2. GN= OC=Viruses; ssDNA viruses; Anelloviridae; Alphatorquevirus.
Sequence
LTKDTSXYDKTQSKCLIQDMPLWASVYGFSEYCSKVTGDTNIEHNCRCVIRSPYTVPQLL
DHNNPLRGYVPYSF
Download sequence
Identical sequences A0A1B2ZDH6 Q9J1S1
Q9J1S1_9VIRU

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]