SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B3E869 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B3E869
Domain Number 1 Region: 29-107
Classification Level Classification E-value
Superfamily Quinohemoprotein amine dehydrogenase C chain 8.37e-43
Family Quinohemoprotein amine dehydrogenase C chain 0.0000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B3E869
Sequence length 107
Comment (tr|A0A1B3E869|A0A1B3E869_9PSED) Quinohemoprotein amine dehydrogenase subunit gamma {ECO:0000313|EMBL:AOE85722.1} KW=Complete proteome OX=1856685 OS=Pseudomonas sp. TCU-HL1. GN=THL1_3174 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKHLKPLNNKAQMLEKAAAEDRIEEVMAMSAVAGCTATTDPGWEVDAFGGVSSLCQPMEA
DLYGCSDPCWWPAQVPDMMSTYPDWNAQATNSQEDWRNLGTVFPKDK
Download sequence
Identical sequences A0A1B3E869
WP_069084090.1.38891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]