SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B3F133 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B3F133
Domain Number 1 Region: 3-161
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 0.000000000994
Family Hypothetical protein YwqG 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B3F133
Sequence length 169
Comment (tr|A0A1B3F133|A0A1B3F133_ENTCL) Uncharacterized protein {ECO:0000313|EMBL:AOE95477.1} OX=550 OS=Enterobacter cloacae. GN=BFJ73_09735 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MFPLLQIRIDELPVIPEQLKDVALLVLFHNIESHPFDKPHGEGWLIREYATLEGLELLPA
TDTPYRAFPVRWIGVNDDAPGWEDAWDIIDLSDVNDDQEASDRFHDDFKRYRGTKVGGYP
MKIQHGVGIEDFVFQVGSEEKVNWMWADNGIGYFHKSPEGLWTFSCQFY
Download sequence
Identical sequences A0A1B3F133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]