SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B3NFX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B3NFX1
Domain Number 1 Region: 4-127
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 5.49e-28
Family CobE/GbiG C-terminal domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B3NFX1
Sequence length 129
Comment (tr|A0A1B3NFX1|A0A1B3NFX1_9BRAD) Cobalamin synthesis G family protein {ECO:0000313|EMBL:AOG04242.1} KW=Complete proteome; Reference proteome OX=1842539 OS=Bosea sp. RAC05. GN=BSY19_870 OC=Bradyrhizobiaceae; Bosea.
Sequence
MTGRLVVGLGLRADTTEADILACLDAALAIAGLSGEATPRLATLASRIGEPGLAAAAVSR
AAELIGVPDEALKGFEASCATRSTRIASLYGVGSVAEAAALAAAGPGGTLVQPRIATARV
TCALARSSS
Download sequence
Identical sequences A0A1B3NFX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]