SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B4QVQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B4QVQ1
Domain Number 1 Region: 47-179
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 9.68e-51
Family Ecotin, trypsin inhibitor 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B4QVQ1
Sequence length 180
Comment (tr|A0A1B4QVQ1|A0A1B4QVQ1_9BURK) Ecotin {ECO:0000313|EMBL:AOK30308.1} OX=1740163 OS=Burkholderia sp. Bp7605. GN=AQ611_13555 OC=Burkholderiaceae; Burkholderia.
Sequence
MKSVIRSAANAACVAVFAGFCGFAVAASEPSPDAAADAASAPKLSANDVKMFPAAKPGQK
RVVIALPAERQEDDIRVELIVGKTMQVDCNSHWFGGDLKHETVQGWGYSYYSLADAKGPA
ATLMACPSQAAREDFVPVRGSGYLLRYNSRLPIVVYVPSGFDVRYRLWYASNEVARAVER
Download sequence
Identical sequences A0A103DVG4 A0A1B4QVQ1
WP_059520352.1.37738 WP_059520352.1.50573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]