SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B4ZBJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B4ZBJ8
Domain Number 1 Region: 23-123
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 9.55e-40
Family Chemosensory protein Csp2 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B4ZBJ8
Sequence length 125
Comment (tr|A0A1B4ZBJ8|A0A1B4ZBJ8_OSTFU) Chemosensory protein 7 {ECO:0000313|EMBL:BAV56811.1} OX=93504 OS=Ostrinia furnacalis (Asian corn borer). GN=OfurCSP7 OC=Pyraloidea; Crambidae; Pyraustinae; Ostrinia.
Sequence
MKTFAICLLALVAVVSAYPQAKYTDRYDSINLDEIVGNRRLLVPYIKCILDQGKCSPEGK
ELKSHIKEALENYCAKCTETQRDGTRKVIGHLINNESEYWNQLTAKYDPQRKYVVKYEKE
LRTVS
Download sequence
Identical sequences A0A1B4ZBJ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]