SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B5L7E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B5L7E6
Domain Number 1 Region: 24-151
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 6.28e-23
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0005
Further Details:      
 
Domain Number 2 Region: 328-467
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000405
Family Pseudo ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B5L7E6
Sequence length 532
Comment (tr|A0A1B5L7E6|A0A1B5L7E6_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:GAO19441.1} KW=Complete proteome OX=1159556 OS=Ustilaginoidea virens. GN=UVI_02023390 OC=Hypocreales incertae sedis; Ustilaginoidea.
Sequence
MRAIVDDVVPRLTQTIIVMENRSLASGHGERVDDVEFFRQQAFELVEWADLLVCVPLDAD
GIAKMLAGVADTFLGEVLRGWNMHKSIVLVPGMSTHMWSHPMTKRHLSKIHRKWNWIRVM
TPILWHFEGQPNPKRVPNWNGFNEVLGIIKNQADLLGLGRDVEIATGTVVVPDSDVKIRS
KLPPEIWTMVLDHAGDWELAKALGMYTNLPMPSAWSLEPRDPADPLKVYEHDLEWTVLTG
NSAAICKKLSQSPPAFRDVPALVVKLIIRFGLIDVLAYMEANRPDLFKAFDGTTLPTNAS
AYYPRTDVLDFWKQSKWFREDLIYDAEAVDGASKNGHVRVLDWWWRRSGLPLRYTEAALE
QASGRGHLLVLEWWRDAAAQDEEVVLRPGRSLLWATQHGQAAVLEWWGASGIPVAHGDAV
AKVASRWGQVQVLETWRRFKGDSKLVFDPEVLLSSTIHQHVDVLEWWRKFAHGELEGMEG
RKQPVEFRTCNIEEALEDSIGDQDQNKARKWWAKYGLDLRMRNEEWLQTRYL
Download sequence
Identical sequences A0A1B5L7E6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]