SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6D046 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6D046
Domain Number 1 Region: 104-227
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-34
Family cAMP-binding domain 0.00000997
Further Details:      
 
Domain Number 2 Region: 239-365
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-31
Family cAMP-binding domain 0.0000591
Further Details:      
 
Domain Number 3 Region: 7-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B6D046
Sequence length 379
Comment (tr|A0A1B6D046|A0A1B6D046_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS19048.1} OX=38151 OS=Clastoptera arizonana (Arizona spittle bug). GN=g.28216 OC=Cercopoidea; Clastopteridae; Clastoptera.
Sequence
MSRPPSGKINVPDELRDVLLEFTISYLLEQPPDVVEYAVEFFTKLRDNKTSIVAPRTSSP
DDSIASGEIDEPPVSRFNTRRKSVFAEAYDPEDDDDDGQKVVFPKSDEQRQRLADSVKNI
LLFRSLDKEQMNEVLDAMFEKKVTDGDYIIKQGDDGDNFYVIQSGTYNTYVDDNGEQKLI
HTYQDKGSFGELALLYNMPRAATIQAASEGSLWAMDRQTFRRIVLKSAFKKRKMYETLID
CVPMLKTLQSYERMNLADALAPKSFEDEEIIIKQGDAADGMYFVEAGEVKITILDEEAKE
IEIKTIGKGGYFGELALVTHKPRAASAYASGPTKLAFLDVEAFERLLGPCMQIMKRNIDD
YEGQLIKIFGSNHNITDVR
Download sequence
Identical sequences A0A1B6D046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]