SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6DKH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6DKH1
Domain Number 1 Region: 80-116
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000353
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 
Domain Number 2 Region: 28-98
Classification Level Classification E-value
Superfamily Hypothetical protein YqbG 0.0000745
Family Hypothetical protein YqbG 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B6DKH1
Sequence length 117
Comment (tr|A0A1B6DKH1|A0A1B6DKH1_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS26189.1} OX=38151 OS=Clastoptera arizonana (Arizona spittle bug). GN=g.7122 OC=Cercopoidea; Clastopteridae; Clastoptera.
Sequence
LAKRNITILGKFEDIVLEHITILNKKGKILNHHWSDSKFQLLSEIENTSALEAAENDNLK
NNMESKYKDFKFESLMASKLYLKDNISVYQLIQDFLNNVLIKKPEDPIKYAINFFKH
Download sequence
Identical sequences A0A1B6DKH1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]