SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6E155 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6E155
Domain Number 1 Region: 110-179
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 7.72e-30
Family AN1-like Zinc finger 0.00017
Further Details:      
 
Domain Number 2 Region: 12-58
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000131
Family A20-like zinc finger 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B6E155
Sequence length 184
Comment (tr|A0A1B6E155|A0A1B6E155_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS31650.1} OX=38151 OS=Clastoptera arizonana (Arizona spittle bug). GN=g.10041 OC=Cercopoidea; Clastopteridae; Clastoptera.
Sequence
MERESNSMQAYCRSGCGFYGNPATDGLCSLCYKEALKKKQQPPSTSSSASFSSSTPTPPS
SLKDTQTAVPTIPVISPSPITASLLSDKDVDGEVAGSSSAESNAELEDSIDSKDDKDAKK
KKNRCAMCRKKVGLTGFECRCGGLYCAVHRYSDKHECSFDYRELGAQEIRRNNPVVVGEK
IQKI
Download sequence
Identical sequences A0A1B6E155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]