SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6EH90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6EH90
Domain Number 1 Region: 11-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000732
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B6EH90
Sequence length 474
Comment (tr|A0A1B6EH90|A0A1B6EH90_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS37277.1} OX=38151 OS=Clastoptera arizonana (Arizona spittle bug). GN=g.11188 OC=Cercopoidea; Clastopteridae; Clastoptera.
Sequence
MPDLVEQMYCSQQINIPPNLPFILKQYAKAVIRTQPRDLLFWSVNYFRAKAQNLPPPVKD
RIEFPSVDSPSGLSPGFIKVLQKQLGHLEYVNKEVLYEKWLGVCLKEEALTTILKLGHFV
DDVFWLHFLAIAAAYISPTLTHTMSLICELLTDEPDGGSAMISVETFNSLYMFLARLDCG
LPQIVQENTIKDSVNSLTKEIDSEESLTIIKEEKLSNEMDIEVDSHDGIMIWPDIAPTKV
RSRESSFEGAISEDGLMVVDDVTKVSQYTDPKSQALEAMDKSSFDDDDVDKHEPEESIHT
SQEFTSTMELTNMQAPEISKMIKTKSCFAHNQKALGIKEKSSTTANIIPFTKSELETEKN
DFDKEISSLPSTQYLGIIIDGVNKSVGNEQEGKDKKIQSSSTLSSNFETNADKKLLECIP
GIGPIIPEDHIQAVIEYMNCCADKQEGMVMLRNIRHFLCPPLDYPDASNNSIIT
Download sequence
Identical sequences A0A1B6EH90

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]