SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6FXY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6FXY8
Domain Number 1 Region: 101-221
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-35
Family cAMP-binding domain 0.00000118
Further Details:      
 
Domain Number 2 Region: 230-352
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.01e-31
Family cAMP-binding domain 0.00000215
Further Details:      
 
Domain Number 3 Region: 1-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 8.63e-20
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B6FXY8
Sequence length 363
Comment (tr|A0A1B6FXY8|A0A1B6FXY8_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS55044.1} OX=1464854 OS=Cuerna arida. GN=g.21309 OC=Membracoidea; Cicadellidae; Cicadellinae; Cuerna.
Sequence
SLRECEAYVQRHNIQQVLKDCIVQLCVSRPENPISFLRVYFQKLEKEQAHDAKQAAVSPE
DTEDLSPLPNQSHQPVRRRGGISAEPVSEEDATSYVKKVVPKDYKTMAALSRAIAKNVLF
SHLDENERSDIFDAMFPVNFLPGEPIIQQGDEGDNFYVIDQGEVEVYVNTELVTTVGEGG
SFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILES
LDKWERLTVADALEMVAYEDGETIVRQGEPGDDFYIIVEGTALVLQHRAEGEEPTEVGRL
GQSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERLLGPCADILKRNITQYNSFVS
LSV
Download sequence
Identical sequences A0A1B6FXY8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]