SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6GE77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6GE77
Domain Number 1 Region: 185-301
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 2.62e-40
Family eIF-2-alpha, C-terminal domain 0.00000575
Further Details:      
 
Domain Number 2 Region: 89-181
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 7.32e-32
Family eIF2alpha middle domain-like 0.0000534
Further Details:      
 
Domain Number 3 Region: 10-91
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.36e-18
Family Cold shock DNA-binding domain-like 0.0000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B6GE77
Sequence length 327
Comment (tr|A0A1B6GE77|A0A1B6GE77_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS60721.1} OX=1464854 OS=Cuerna arida. GN=g.11146 OC=Membracoidea; Cicadellidae; Cicadellinae; Cuerna.
Sequence
MPLTCRFYKEKYPEVEDVVMVNVRSIAEMGAYVHLLEYNNIEGMILLSELSRRRIRSINK
LIRVGKTEPVVVIRVDKEKGYIDLSKRRVSPEDVEKCTERFAKAKAVNSILRHVAELLHY
ENNEQLEDLYQRTAWLFEERLKKKASAYDFFKQAVLDPSILTECGLDEKTQEVLLNNIKR
KLTSQAVKIRADIEVACYGYEGIDAVKAALKAGLACSTEDLPIKINLIAPPLYVMTTATP
EKADGLVALQTAIEEIEKTIKSMGGVFQIQMAPKVVTATDEAELARQMERAEAENAEVAG
DDDEEEENGEGDAEVDAPSADEGEDED
Download sequence
Identical sequences A0A1B6GE77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]