SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6I8Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6I8Q8
Domain Number 1 Region: 9-122
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 1.83e-26
Family Taf5 N-terminal domain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 181-217
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000084
Family WD40-repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B6I8Q8
Sequence length 226
Comment (tr|A0A1B6I8Q8|A0A1B6I8Q8_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS83336.1} OX=320908 OS=Homalodisca liturata. GN=g.36418 OC=Membracoidea; Cicadellidae; Cicadellinae; Homalodisca.
Sequence
ILELPEGKCRHELHAMLFPLLCHLYLEILRGGLDRQATSKFLKRHQELFLGHENHRDIIE
ELSLVFTTQDIDSKPLIKAFRSCKYELKISSSTMAALQKYLATQSHVILLQVLQTWFDIE
VLSSDSVFESEDYVLEDYVDETADYLESLYQQTHDDKEMRHLQEMIRQVRASPTPPPPLL
LYSLNNSESVCCAKVSRSGKLMASGYSSSQLKLWSLSESKIGPAAG
Download sequence
Identical sequences A0A1B6I8Q8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]