SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6J8R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6J8R9
Domain Number 1 Region: 8-121
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 7.72e-16
Family Insect pheromone/odorant-binding proteins 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B6J8R9
Sequence length 125
Comment (tr|A0A1B6J8R9|A0A1B6J8R9_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS95582.1} OX=320908 OS=Homalodisca liturata. GN=g.7658 OC=Membracoidea; Cicadellidae; Cicadellinae; Homalodisca.
Sequence
LQGLVFVALLLAALALVNAKIDYDEYEKKFNVCKEETKAEETFEDTIKNEKIPTSDKGMC
LVECLLRSQGVYDSDGKYKPEGAKEYFSKVFSHLPENIEKSIAIAEECSKMDVEGLDKCE
EIGRA
Download sequence
Identical sequences A0A1B6J8R9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]