SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6L896 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6L896
Domain Number 1 Region: 227-349,379-426
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-16
Family Nucleotide and nucleoside kinases 0.0063
Further Details:      
 
Domain Number 2 Region: 18-56
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000837
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B6L896
Sequence length 543
Comment (tr|A0A1B6L896|A0A1B6L896_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAT19920.1} OX=36148 OS=Graphocephala atropunctata. GN=g.2151 OC=Membracoidea; Cicadellidae; Cicadellinae; Cicadellini; Graphocephala.
Sequence
MAVDATMRKLKIPQKFMPYLEKHRVYELLHDLGEKLAMEQPSDPLQFLKECLGRLLEGRD
HRLIILMTPPSLDRTRLAQMISQKTGYGIVSRYLMKTPGNFYDPDTLAEFTTKYVSSSER
EGWILSDFPDSMEEAKHLIKAGVVPTHAFLLLHKGQNEVEEHETMHTVDTSPSILLEHGN
SLYHMRELFKSSLKVVKMKDRSMEDVADLCAKLTIKMPPHLAPKLFRVALLGPRGSRRRT
LAKLLNKRFKMVHVDMNHLINTAKMMENEMGDEIRFWDRNDYTYSTKIIFPLLKDRLQQN
DCLERGYVLTNFPTCVEDFIFLDSLDTPPNRVIFLDIDVNECLARLEDRVVNMYTGDLHS
KKSIEANSSLKSQTLPHPDDDSCKVTEENKFYLARLKSMLEYCGGTCSVVDGKGPIKALF
ERVEAVLMSSSPAANPRSDKMPRLSLVKHEQLSVKSRMSYPTSRTEIVPLIDTDELNRRF
KYLKGEMSSDIQEPDNSSTIRGDSVHLEDGTESPMEFVENDQSGVAVIQLFKGVKIKSSG
DIL
Download sequence
Identical sequences A0A1B6L896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]