SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6Z875 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6Z875
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily RPA2825-like 4.84e-38
Family RPA2825-like 0.0000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B6Z875
Sequence length 121
Comment (tr|A0A1B6Z875|A0A1B6Z875_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:OAO01309.1} KW=Complete proteome; Reference proteome OX=1849171 OS=Sphingomonadales bacterium EhC05. GN=A8B75_15625 OC=unclassified Sphingomonadales.
Sequence
MSIFGKIKSAIFGGEAKAAEPEAAPAAAAAAPAARAAISEVDVEGRLDSIPGSDKLNWRS
SIVDLMKLVGIDASYGNRKELAQELGNSDYSGSAEDNILLHKQVMNKIAAAGGIVPADLK
D
Download sequence
Identical sequences A0A1B6Z875
WP_066745472.1.93962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]