SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7N6L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B7N6L3
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.27e-18
Family Inhibitor of apoptosis (IAP) repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 123-190
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 5.63e-18
Family Inhibitor of apoptosis (IAP) repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B7N6L3
Sequence length 213
Comment (tr|A0A1B7N6L3|A0A1B7N6L3_9HOMO) Inhibitor of apoptosis repeat-containing protein {ECO:0000313|EMBL:OAX40461.1} KW=Complete proteome; Reference proteome OX=1314800 OS=Rhizopogon vinicolor AM-OR11-026. GN=K503DRAFT_687521 OC=Rhizopogonaceae; Rhizopogon.
Sequence
MESLQARVDSFLKSKRIKKTSKSNSTSTTVKWPHPASFNANPKTLGEAGFYWVPSWEDRD
SVACFLCYKELSDWNEEDDPFQIHWEKCGRSCAWAMLRCGLSQDIADDGSFVFLNKGRLP
TSKMMEGARLRTFGANLWPHDADDGHGASSEKVARAGFVYTPHSKGDDTVTCLYCEAALG
NWHEDDDPMYVNEPSLRYKVTHPHQAGTREACR
Download sequence
Identical sequences A0A1B7N6L3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]