SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7NIG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B7NIG2
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 2.09e-21
Family tRNA-intron endonuclease catalytic domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B7NIG2
Sequence length 124
Comment (tr|A0A1B7NIG2|A0A1B7NIG2_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:OAX44693.1} KW=Complete proteome; Reference proteome OX=1314800 OS=Rhizopogon vinicolor AM-OR11-026. GN=K503DRAFT_861301 OC=Rhizopogonaceae; Rhizopogon.
Sequence
MQNHPSYAVLGQVLAKYPASGGALFQVYNDLTLAQRWSDIQILDLTACGRAAIKGKRPTT
DTDQGPSTCVVVPCSLSESISTSWLRAAFTSLEPSPTEIYVAITTEDTSTVYYKISQGIV
KPPV
Download sequence
Identical sequences A0A1B7NIG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]