SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7NQL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B7NQL6
Domain Number 1 Region: 11-117
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 2.49e-26
Family Thiamin pyrophosphokinase, catalytic domain 0.00095
Further Details:      
 
Domain Number 2 Region: 164-269
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 5.23e-20
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B7NQL6
Sequence length 275
Comment (tr|A0A1B7NQL6|A0A1B7NQL6_9EURO) Thiamine pyrophosphokinase {ECO:0000256|PIRNR:PIRNR031057} KW=Complete proteome; Reference proteome OX=1658172 OS=Emmonsia sp. CAC-2015a. GN=ACJ72_06599 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Emmonsia.
Sequence
MRKSGRESIELPDAIVGDLDSISPDVRKHYEDLQVPVIHDPDQYSTDVTKCLCYLRSRTQ
SVIEPSQPAPSIDSSRDSTAAAEEKTPPGDIDVLLLGGLGGRVDQAFSLINHLYTSSTST
APSTSTPSPSAPSAASASASSSSFPPPPPPNNKQNQLYLISEESISFILRRGHNRIYTPG
GSLMGPSPTASPQSPPSQTQPTPLAENVGIIPIAGPAVITTQGLEWDVRDWKTHFGGQVS
TSNHVRSEVVEVEVDAEVPVMFTVELAGWLKGGAV
Download sequence
Identical sequences A0A1B7NQL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]