SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7NV87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B7NV87
Domain Number 1 Region: 104-200
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00000000000353
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.001
Further Details:      
 
Domain Number 2 Region: 363-376,430-541
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000654
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B7NV87
Sequence length 625
Comment (tr|A0A1B7NV87|A0A1B7NV87_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OAX80688.1} KW=Complete proteome; Reference proteome OX=1658172 OS=Emmonsia sp. CAC-2015a. GN=ACJ72_04971 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Emmonsia.
Sequence
MAVDFTSPHDFSAQNSKLEAPRYKVTRMPGIPLDNKGPDTETGLDTPVYGGKTGTMVGDP
DMEFDKNNWSSCAKLPFNNKLRKHVLISTNSSFAEVAIPLLLEISDIELRVISDGVVDHA
QCTCPIDAGTLGAMIAGLTTNLTLTVMRGWDINKAVLLVPGMAISEWQSPVTKRQLNDLA
TYWSWVKVLPPALSQFEPPAGLVEIPWDSWATFISEIRNCLGCSSPSSTGHEDYMLIKDV
SSGNGSTSLAISTSSVHEREQPVSKEKDQNGANEDQAIVIRKENPILPPELLTMIFEKLD
DWETAASVGVYAKIPVPERWKPYIPTPGTPATFEYTVLRGSMKEIEQHLATIPPHNPLSR
IVTDLILKFSRTDILDSLCKLRMDLYLSTPQLKNLPLSASSKFGSTSLLSWWQHSPSLPT
LPIKAYLPEAIDAASRAGFVHVLEWWRRSGLPFRYTERALESASAEGKIAVLDWWKNASK
NAAPDDPLPLKVGKSVLLAAQSGCTDSLAWWDRSDIPFSHAESVTRIASNHGHVPVLDFW
YRRKREKLIFDNQVLVGATKNGHVEVLEWWKRSGLPVEFKTCDIEEALEDAVSGVEQRVR
RWWARNGLNLGVGTNEWMMVKTLNT
Download sequence
Identical sequences A0A1B7NV87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]