SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7SJX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B7SJX5
Domain Number 1 Region: 61-150
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.02e-21
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.000000000000235
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B7SJX5
Sequence length 151
Comment (tr|A0A1B7SJX5|A0A1B7SJX5_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:OBA16787.1} KW=Complete proteome OX=460523 OS=Ogataea polymorpha. GN=OGAPODRAFT_16310 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Ogataea.
Sequence
MNQYLQQKLLTDVEGTCTGQFGYIICVLDSMSIDVGKGKIVPGQQGYAEFEVKYRAVVWK
PFKGEVVDAIVSSVNNMGFFADVGPLSVFISKHLIPKDMKYTPSHTPPAYISEDQVIMKG
SKVRIKIIGTRSDVNSISAIGSIKEDYLGPL
Download sequence
Identical sequences A0A1B7SJX5
XP_018211702.1.52233 jgi|Hanpo2|16310|fgenesh1_kg.3_#_341_#_isotig02608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]