SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7SLS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1B7SLS6
Domain Number - Region: 241-316,405-462
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0131
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B7SLS6
Sequence length 698
Comment (tr|A0A1B7SLS6|A0A1B7SLS6_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:OBA17422.1} KW=Complete proteome OX=460523 OS=Ogataea polymorpha. GN=OGAPODRAFT_75356 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Ogataea.
Sequence
MSFDDFMDSQKVVYELKPAARVAFPDLPLVYYQEGVPTESALPFVRLLKGNEPTENVYRR
YELFVNNWAKQHDQILQILQKHEKNMFVDLQRYLSSDESSTVFKDQPINLSTALLNLGPN
ISNHSLLLQNVWQNLVDESPDAIVVRLSSKVCSTVSFTMKILATDISRGLKTDLGRAASV
PVSDSDDEMNSEPEDDEGQTRTIEMDSLMEKVFSKDKRLIVMIEDADSFPTSILTPLIKV
LWNYNNQYRSRIRLVIGMSTPFEIFHEKLPKLTVKYMRPKYFQIDNTGQAVNEIMENVLL
NINDTYDSLILEPRLVLKFLELKLKISISQFVNSMKVIYMSHYYSQPLSVMWTNDFSKIQ
LNSHVFDVFKRLPSVRRYEQSLHAKKAATLHKLLVSDDEAALGDLLRQSLNKLIHWRYRM
KTLVDLLNFMQEYFLETSIWTDNLDLFRLIFENVSYEEEHSNFENFKFLHHLWSKIRSSS
LHDVNSFIKTVREDADFGPLFENDDLRELSAASQTKQFVAALNRALLRCLEELNLNNIPF
REICCVDLSALDLLTNTFNPQVRATCIESLLNSKNYLLNTVHSDPSQLDRESFDMKLYKC
LEPSVIELYRLSREAGVITNVYDFYQVFKSSLPREELENTLREKSPQTQLPAEIDDLTWD
KMTLSWFLKSLAELQTLGIVREVKNKSETLEKIIWKDL
Download sequence
Identical sequences A0A1B7SLS6
jgi|Hanpo2|75356|estExt_fgenesh1_pg2.C_2_t10342 XP_018212234.1.52233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]