SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B8AJE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B8AJE9
Domain Number 1 Region: 1079-1281,1316-1356
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.74e-50
Family Ankyrin repeat 0.00056
Further Details:      
 
Domain Number 2 Region: 1257-1476
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.36e-34
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 942-1116
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.14e-20
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 740-889
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000017
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B8AJE9
Sequence length 1532
Comment (tr|A0A1B8AJE9|A0A1B8AJE9_FUSPO) Uncharacterized protein {ECO:0000313|EMBL:OBS20434.1} KW=Complete proteome; Reference proteome OX=36050 OS=Fusarium poae. GN=FPOA_06804 OC=Fusarium.
Sequence
MSEEAFIEDESTAFHTNAMIDDPKTEDGPTGEPESRGTSPAREADVIEELKWRTNDDDDY
DSIRLPHYIYDAVVIHGISSQSSKRCDLDTITPFIRDTLKGVAEEQGRIITWGYYRNVEE
GRYYTPDGVYKEAEDMLDYLCDLRTSEIKEMRRPIYFFSHDIGGTIVKAIQALSLASKHG
TQYSEIFECTRAMYFFGYPHRCPNPGILEDAILRIMAQESLGWPGGMLNYARSLRDTILD
VNDSFLQTQILTQANFINVVSTHQDPVQQIFPFSMSTMGTPFERVVKMESPHSDLILAGS
DGSHPVNDIADLDWLTGGLTDKQHVAFRKLVNQASPVFPYRKIDTSWQHPDLLELPKVNK
NYIIHMRCSHGADELSENASFFLDNHRKGIFQPLLFMKFDANDVRFNNCEAMLRSFLARF
TSNRLQSGDFVARTSRGMTDIKFRNVIDLFNRWEVLLNNSDSFGDGIHVLGCFDNCDDSA
IWFLTQVRKLFLRSEVGLKMLIITTKGSPGDSHITSTLSEFPTENVKSIEYIPADPPPFP
VDVETSKFMQRYSSLVGIDQRSQLRTMLSPYANDHQLCELVLQWLSSDKEQIKRIPTLSE
KSLTPAILFLEILDSIPVSERAWAKIVISWLLASYRPLRSEELLRVSDLAWTRTHGNNFM
PPGLHDIQKRLRGILTIENGEVHFRHSDMRYWLGSQQTAFNEKMWYYTTELGRHNTILHT
CIDHLNDMTRNTKGWAHSLPYAIEFWSQHSESADASEDLLLSLFENEPVFQRWANALVEI
PNRRLNPLPEHINPLYIASHLGLTTLVKKLLEGHSYEATLLNQALIEACRVGHASLIRLF
LDSKLFDLNLSNYVMHEAAKAVSGVGDGNDEALRELINSLPMPLDSHNVQMSRTDRRDDN
YEAKENQPTDNSMDNSSFELQAAGDETQNDGYESDPLEWLTMPMYRAAGSGMEDVVAKLL
QLGLKPNPSKGITPHSMSYLHSAVGDSRYGCTKLLIDAGASLTYQNDSGKSVFEHAIAWS
SGEVIQLLLDSGARVDEIQTCGDMPLGSAMFLGSFEATKVILSYRDYHEYFFHDPDKHPV
NAATENGNQRCLELVLDQGFSPNNVTSSGETALRTAIEKGRFDLCELLLQHGADPDLTPE
GTRTPLIQAIFEGDLGMVKLLVEHKAAIDKREMPPDAGWSRTPMHIAVDWKKPTIVEYLL
QQGADPNARDSDGVPVIMAAADSGDADVVQWLLDKGSVTNLTSYSDERTALQEAVPHPEV
VRVLLQHGADITTSNSESRTPLDFAISSNYLESVQIILEKCRDVLDLDSETIRQELCLAV
VNGFTDVVGALLEAGADVNTVNEDGESLLMLAVKHNAESDMVCKILEYNPNVAIRDNKQN
TALHQIKDFTVLETVRRIVNSGAKLDVVNDSEETPLVLAIRAQLDDVFSYMLRKQPTLVH
RGLASSNTILTPLHEACIKGSLFMVQSLINYKVEVNSCCEWLYGTPLVAATLRWSTASHT
GLASDIMAPTQEFRAVYSDIHLSQHVWDVLQT
Download sequence
Identical sequences A0A1B8AJE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]