SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B8B507 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B8B507
Domain Number 1 Region: 33-119
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000248
Family Pseudo ankyrin repeat 0.037
Further Details:      
 
Domain Number 2 Region: 2-48
Classification Level Classification E-value
Superfamily F-box domain 0.0000436
Family F-box domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B8B507
Sequence length 217
Comment (tr|A0A1B8B507|A0A1B8B507_FUSPO) Uncharacterized protein {ECO:0000313|EMBL:OBS27814.1} KW=Complete proteome; Reference proteome OX=36050 OS=Fusarium poae. GN=FPOA_01757 OC=Fusarium.
Sequence
MAPSNSTPNLHTMPPEILLDIMSFADTFKSKALLARTCSRLYKTLIDEVYKQASTSKVLV
GDVIYEACRDGNVLTLERFFINDSMICRYDRSLYTAIYYYQVDVVRWLLEHGTDPNFAVN
QEVLTLSDLPLHLAVISVLEPGIPQWRIPMKWRKQGFVMPPKDYWRDAGRAIIKLLRDAG
ADESDVLTQIDRDHLDSIQANRYCCRNHPVSGSVPRQ
Download sequence
Identical sequences A0A1B8B507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]