SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B8B5B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B8B5B0
Domain Number 1 Region: 28-96
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 1.44e-27
Family Hydrophobin II, HfbII 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B8B5B0
Sequence length 98
Comment (tr|A0A1B8B5B0|A0A1B8B5B0_FUSPO) Uncharacterized protein {ECO:0000313|EMBL:OBS27909.1} KW=Complete proteome; Reference proteome OX=36050 OS=Fusarium poae. GN=FPOA_01850 OC=Fusarium.
Sequence
MKFSLAAVTLLGAVVSALPANEKRQAYVPCTGLYGSSQCCATDVLGVANLDCGTPPSVPA
NATDFSAVCAEIGQRARCCVLPILDQGILCNTPAGVQD
Download sequence
Identical sequences A0A1B8B5B0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]