SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B8SPZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B8SPZ3
Domain Number 1 Region: 24-155
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 3.92e-52
Family Ecotin, trypsin inhibitor 0.00000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B8SPZ3
Sequence length 158
Comment (tr|A0A1B8SPZ3|A0A1B8SPZ3_PRORE) Ecotin {ECO:0000313|EMBL:OBY34786.1} KW=Complete proteome OX=587 OS=Providencia rettgeri. GN=PR729_24785 OC=Morganellaceae; Providencia.
Sequence
MKKAILSVMAAALISSCAVATEDLEKIAPYPKAESGMTRHVIELTKQQNENDFMVELVIG
KTIKADCNRQWFMGDLDKKTLEGWGYDYYKLDEVKGPASTMMGCSEPAKDRFVTTQLGDD
AFVRYNSKLPIVVYAPKDMQVKYRIWSTDDKLIDSVNK
Download sequence
Identical sequences A0A1B8SPZ3 K8W3B5
WP_004913002.1.76225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]