SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B9FV09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B9FV09
Domain Number 1 Region: 25-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.47e-17
Family Txnl5-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B9FV09
Sequence length 119
Comment (tr|A0A1B9FV09|A0A1B9FV09_9TREE) Uncharacterized protein {ECO:0000313|EMBL:OCF22595.1} KW=Complete proteome; Reference proteome OX=1296100 OS=Kwoniella bestiolae CBS 10118. GN=I302_08245 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Kwoniella.
Sequence
MPLLANPYPHVFNSLNSTDSPAVSYLVFYSNVVNGQMWCPDCRDVESTIKETFDAPDKPK
AIIYWVGDRPEWRTPKNKARVDWDVQSIPTILRIENGKETARLVESEILDKQKLDQFLK
Download sequence
Identical sequences A0A1B9FV09
XP_019043665.1.86477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]