SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B9HBQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B9HBQ6
Domain Number 1 Region: 1-106,144-186
Classification Level Classification E-value
Superfamily GINS helical bundle-like 3.14e-29
Family PSF1 N-terminal domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B9HBQ6
Sequence length 238
Comment (tr|A0A1B9HBQ6|A0A1B9HBQ6_9TREE) DNA replication complex GINS protein PSF1 {ECO:0000313|EMBL:OCF40698.1} KW=Complete proteome OX=1296119 OS=Kwoniella heveanensis CBS 569. GN=I317_05470 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Kwoniella.
Sequence
MYGDLALQLVTASHRSTLSTTPQLPLPKYALPLILAIALETRQLGTSITSAAETHGQVSL
SQDRALVCNLTVQHLAARRNKRCLLAYLATRVGGIKERWWDAGGGLAYLLSSNNSNNTLQ
SNSTSNSNTAGGNSNAAANPESDSQDLRSNLSPQELDFLRGYNTLLLDYKSDFLDVLDLT
ASIDRPPGELMVDVRVIRDAGEVVLDGGERIDFRKGERFRLARSGVERLIVQGFLEEV
Download sequence
Identical sequences A0A1B9GXK6 A0A1B9HBQ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]