SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B9HRD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B9HRD5
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily PriA/YqbF domain 3.73e-19
Family PSF3 N-terminal domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 66-183
Classification Level Classification E-value
Superfamily GINS helical bundle-like 2.67e-16
Family PSF3 C-terminal domain-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B9HRD5
Sequence length 192
Comment (tr|A0A1B9HRD5|A0A1B9HRD5_9TREE) DNA replication complex GINS protein PSF3 {ECO:0000313|EMBL:OCF45849.1} KW=Complete proteome OX=1296119 OS=Kwoniella heveanensis CBS 569. GN=I317_00337 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Kwoniella.
Sequence
MDDDYFSLNAILADNHKLSCTFTLDVPGLGYLEGGTENDIHQHSKIEMPFWLAQTLSLNE
FTTFPLPPPYSNRVKSALNASAQSVKLSNLVGGNGWWYRWGRRIADVLDDEPQQDLLNML
LRAFTNRLPALQDLSAHHASADHTLPETSTSTGEVFRDGMEGDERELFAIGQDSGRKAKA
WYDSSNGRKYVR
Download sequence
Identical sequences A0A1B9HRD5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]