SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B9JK38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B9JK38
Domain Number 1 Region: 3-49
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000000327
Family Chaperone J-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 556-643
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000745
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B9JK38
Sequence length 892
Comment (tr|A0A1B9JK38|A0A1B9JK38_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OCF93017.1} KW=Complete proteome OX=1196095 OS=Gilliamella apicola. GN=A9G17_07760 OC=Gilliamella.
Sequence
MSTNFWELLGIEQTTDTALIRQAYREKLPSYHPETDPDGFKALREAYESAISYAKSPETA
VDTTTQQSEKESVPQLTEEQIQANEIYNAYQALLEDPQRCYKVDEWQKFIGSFYDYPMSV
IDSVKWRLLTLSYETTNISESCVKILADNLRWRQQLMTQFTDDFQIYDSYLNHIDHGDLF
DYTCLPTTNKALQNATIDYIYSIKWIYWERRPDDVYIFLSQDTVFYLPDDKKLMLEFAFW
HSEANMKNQFILDYALKCIAENDQGEQTIIDWKYIAAIQYTLLEDKHNALQFWLDLYYSG
HYQEKAESWIAGWCVYFEKDYFPLLIMALNNSHCIDTDKTEIYLHTIPQLTTTTTARLAG
IDDIDSYPKEIVDFVNWSLSVNWSYRQVLSILLRDDGSHRLYRLYRHAVMLRHGNEILLQ
EILDEQSNDPFEQFILHHLKRQARQHLTWLKQLSPIQEFKAWLFDDDKNALLPKKFDPDE
EGELVLYGRLWLDRFQELPEVAKLHLYHSFHYSNMEMFDWAMYLEFMKYYLLPEPPNAST
KMNNKNAYWQWFHHCLLVLAIVNQPINVAIYLQQENNNFTIKDDDKLKPLIEIFKHGNWQ
NETELYNLIDNDSKLINCILNNYPDSMEWFIDDPDYIDFNNFEQKIEQLWTPKLAKKNPV
YVILLYLIVLNKPEQKAKLDQTLQKLVGDNKDLKKIANGLKNNWSFPLSVNKNRYHYTKQ
VDEITSLAERLSNQYSVCDDDELKMLDEFKNDSDNDLVLRLCAALLLAKNTENQKWLESQ
SLPQNKWWQFWRWNGRTNIQGFIVQLILSITMLMFLDKNNFDNITNYVILILVAINTLFA
IKRRINDTDKGQPLYFVATIFLLPLLLSPCWLSELKKINRYGPPIEKKTKEK
Download sequence
Identical sequences A0A1B9JK38
WP_065738227.1.64877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]