SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B9N598 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B9N598
Domain Number 1 Region: 3-129
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 8.11e-26
Family Thiamin pyrophosphokinase, catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 143-202
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000000199
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B9N598
Sequence length 206
Comment (tr|A0A1B9N598|A0A1B9N598_9GAMM) Thiamine pyrophosphokinase {ECO:0000313|EMBL:OCG71553.1} KW=Complete proteome OX=1196095 OS=Gilliamella apicola. GN=A9G43_05660 OC=Gilliamella.
Sequence
MSQNRALLFINGEPPQHDFNHLDKYTYIACTDGAYHNYLSTLSIEPNFIIGDLDSYNPNK
AIPSKTQIIHTPDQNKTDFEKAILFLVSKGMKAFDVYGASGHASDHFLGNISVAMRYYHQ
YQITFYDNYCHFFFAKQYQEITNIKDHIISLMPLSKVTGVTITGFQYPLIDATLSLGEFV
SLRNKAISDLVKISFKNGDLMVFVED
Download sequence
Identical sequences A0A1B9N598
WP_065606927.1.33284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]