SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B9QTR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1B9QTR9
Domain Number - Region: 357-400
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0248
Family Pseudo ankyrin repeat 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B9QTR9
Sequence length 463
Comment (tr|A0A1B9QTR9|A0A1B9QTR9_VIBSP) Type VI secretion protein {ECO:0000313|EMBL:OCH69891.1} KW=Complete proteome OX=29497 OS=Vibrio splendidus. GN=A6D94_03285 OC=Vibrionaceae; Vibrio.
Sequence
MLISTRNNKELLTPIHYEMPCGVYLKNDKSAFRPLRNQFNVAQTSLRKLSQNPSSDDLDQ
LLEENVQNWSTLAQSLHHCFIETTRDIELIGWFLVSQSLLDNTLNSTASALAWLTELVEQ
QWVSLNPVLPALKLKGESDQAKAAEQTEAKVKAFFQICGDSEQSTLLYAPLLLMPLVGNI
TFFDYQSAEQKGTVSELKQLVAGSIAHERNRIVDKLANISCCLESLEQLRKQTLIYSQEA
RITPPNFGFAKNLFTKLNNALQQLTNIKHEAKKPVIPNQQLASSEQGLEVSDMNSDLSHM
ASSVAIQSVTEQDHMLASTNNLSGIADTNRMNRDLAFRQLRELSNYFRQSEPHSPVSFLL
EKAIRWGYLSLPKLLQEMMEEQDGDSQSKIFNAVGLNHLDQVLLPDLEAPTTAFKKPSVP
TTVKQVALPTKAEEFVSEASTADTQFQQKREAPVLSDRTSLEW
Download sequence
Identical sequences A0A1B9QTR9 A3USE6
WP_004731270.1.16835 WP_004731270.1.34429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]