SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B9UMC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B9UMC3
Domain Number 1 Region: 3-121
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 5.89e-28
Family CobE/GbiG C-terminal domain-like 0.00000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B9UMC3
Sequence length 137
Comment (tr|A0A1B9UMC3|A0A1B9UMC3_RHIRD) Cobalamin biosynthesis protein {ECO:0000313|EMBL:OCJ62321.1} KW=Complete proteome OX=358 OS=radiobacter). GN=A6U97_18085 OC=Agrobacterium tumefaciens complex.
Sequence
MVTVAGIGCRKGTCSDAIIAAVHAAELAFGMTVECLATAPLKAKEAGLAEAAKRLALPLE
IVSKEQLEVAASKTMTFSQASLDHAGTPSVSEAAALAAVGENARLVAARLVVGDVAVAIA
TTSDARNDRAIEHGEQQ
Download sequence
Identical sequences A0A1B9UMC3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]