SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C0SX08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C0SX08
Domain Number 1 Region: 17-84
Classification Level Classification E-value
Superfamily WGR domain-like 0.000000051
Family WGR domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1C0SX08
Sequence length 180
Comment (tr|A0A1C0SX08|A0A1C0SX08_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:OCP21875.1} KW=Complete proteome OX=1873715 OS=Ensifer sp. LC54. GN=BC361_25235 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Ensifer.
Sequence
MSYPLDIAVQKFAFSDGNRSNKFYDVYLMVNTHGMAIIVRHWGKKGTSGDLKVEQFAIQK
KAESEFEKLCDSRRRKAYELISSNIKQANTDAEVRMAVGPALWPRIPGPDIKHVLPHLDT
TGRPQETNPARYNENGKWIGEAPARVYSKTEIAKARQAEREAEQVEAVKTYAANPRFGLF
Download sequence
Identical sequences A0A1C0SX08
WP_065783947.1.48127 WP_065783947.1.7674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]