SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C3D513 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1C3D513
Domain Number - Region: 7-62
Classification Level Classification E-value
Superfamily HR1 repeat 0.0017
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C3D513
Sequence length 66
Comment (tr|A0A1C3D513|A0A1C3D513_GEOTH) Small, acid-soluble spore protein, alpha/beta type {ECO:0000313|EMBL:ODA16222.1} KW=Complete proteome OX=33941 OS=Geobacillus thermoleovorans (Bacillus thermoleovorans). GN=A5N86_02260 OC=Geobacillus thermoleovorans group.
Sequence
MARSSNKLLVPGIEQALEQIKYEIAQEFGVQLGAGTVSRANGSVGGEITKRLIAQAQSEL
AGRKTE
Download sequence
Identical sequences A0A0E0T9G4 A0A1C3D513 Q5L1G1 T0NYW8 V6VHG0
gi|261419151|ref|YP_003252833.1| 235909.GK0934 544556.GYMC61_1724 gi|319765967|ref|YP_004131468.1| WP_011230435.1.100150 WP_011230435.1.2219 WP_011230435.1.22479 WP_011230435.1.25743 WP_011230435.1.50933 WP_011230435.1.6497 WP_011230435.1.80994 WP_011230435.1.90668 gi|56419469|ref|YP_146787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]