SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C3N1K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C3N1K1
Domain Number 1 Region: 3-60
Classification Level Classification E-value
Superfamily MbtH-like 1.31e-25
Family MbtH-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1C3N1K1
Sequence length 62
Comment (tr|A0A1C3N1K1|A0A1C3N1K1_9ACTN) MbtH protein {ECO:0000313|EMBL:SBV26446.1} KW=Complete proteome; Reference proteome OX=307121 OS=Micromonospora krabiensis. GN=GA0070620_1935 OC=Micromonospora.
Sequence
MAETRFLVVRNDEEQYSIWSADRELPAGWHETGFAGDREECLAHIDTVWTDMRPRSVREA
TP
Download sequence
Identical sequences A0A1C3N1K1
WP_091589545.1.85994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]