SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C3ZR63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C3ZR63
Domain Number 1 Region: 13-277
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.26e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000175
Further Details:      
 
Domain Number 2 Region: 279-401
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.34e-34
Family Anticodon-binding domain of Class II aaRS 0.0000741
Further Details:      
 
Domain Number 3 Region: 404-476
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 4.12e-23
Family C-terminal domain of ProRS 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C3ZR63
Sequence length 476
Comment (tr|A0A1C3ZR63|A0A1C3ZR63_BACTU) Prolyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_01571} KW=Complete proteome OX=1428 OS=Bacillus thuringiensis. GN=BTT61001_00389 OC=Bacillus cereus group.
Sequence
MAKEQVQAITKMEEDFAQWYTDIVKKAELVDYSSVKGCMILRPYGYALWENMQKVMDEKL
KATGHENVYMPMFIPESLLQKEKDHVEGFAPEVAWVTHGGDEKLAERLCVRPTSETLFCE
HFSKIVQSYNDLPKLYNQWCSVVRWEKTTRPFLRTTEFLWQEGHTIHETAEESQAETLHI
LNLYASFCEDYLAIPVIKGQKTEKEKFAGAKATYTIESLMHDGKALQTGTSHNFGTNFSE
AFDIKFLDRNGKWQYVHQTSWGVSTRMIGGLIMVHSDNNGLVMPPKVAPVQVVIVPIAQH
KEGVLAKATELQEHIQKVARVKIDASNKTPGWKFNEYEMKGIPIRLEVGPKDIEKNQVVL
VRRDTKEKEFISIDQLEERIPALLEEIHNSLFNKAKVFRDENTYSVTNFEEMKKVADEKQ
GFIKAMWCGELACEEKLKEEVGVTSRCMPFEQEHLADECICCGKEAKQMVYWGKAY
Download sequence
Identical sequences A0A1C3ZR63 A0A2A7X6W4
WP_087982312.1.81198 WP_087982312.1.90187 WP_087982312.1.93290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]